NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208852_1004448

Scaffold Ga0208852_1004448


Overview

Basic Information
Taxon OID3300020560 Open in IMG/M
Scaffold IDGa0208852_1004448 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3264
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019779Metagenome / Metatranscriptome227N
F040464Metagenome / Metatranscriptome161N
F043229Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0208852_10044482F040464N/AMNPTVNPEWLRRGYAFVGQTQEHLKDVLKELTLKMRTMTDKEIERDLRKGLKVTGDITLELSRFVRQGLEQKRTFKGLLGTLIETKNWALIRLILEVTEELKERSSSSSLLFSIAKEILRELQRIQATIPIKELEQMETSLINIQYWKLTRHLRI
Ga0208852_10044484F043229N/AMTQKGVKVEIETIEECGCEPHECYCRRNIEYKKSMKIRNLTTMIGLIEADAPLSFRALERICELKKKIKRIDPEWILIDEVKLLEHQVLSQLDTIDHTIPWNSARNKLRYIDLCQSINKLKIIHPDWEMDLENSKNHYLCRCRSCLEKRKMYQQTLDETSLEKSTPYKGSRNKISN
Ga0208852_10044486F019779N/AMKDHPAIDFRPMDVEGEEDRFSETLDSPDIENEIECSGERCFTPPEDDWEIINRGSDFIIHGLENLDEQLDIIATQIDTENQIEEILKNIRKGFSIIDDIILYATTFINEASKAKVEKFRGFISDLLDFAKTNITKTLVIVRKLRARSLLSLIPLTKDLIMEQKHIKKLVSSSNLEQVKELLKEYRRTIRRRVSRRYSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.