NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208597_1013598

Scaffold Ga0208597_1013598


Overview

Basic Information
Taxon OID3300020562 Open in IMG/M
Scaffold IDGa0208597_1013598 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2040
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038245Metagenome / Metatranscriptome166Y
F045760Metagenome / Metatranscriptome152N
F078719Metagenome / Metatranscriptome116Y
F099303Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0208597_10135982F038245AGGAMKIYFGNANDDMFGDGLFEANDNQYYYGVEHGTGPGGLDEVRLFDGCNRYLPIHNEAIPELIAALQEIQKIGEAVKRAQEMTERAESDIKGYVYSSWNDEFEVDFDTE
Ga0208597_10135983F045760GGAGMASSGSKAKQAYAALYKSSTRWATNRKIKLTRVLKQQPNNEQVKDALTNIKYRRQTPTTKTVWSHGNIRLAKLFKEFTGRASVELFSSNPKVQSAALAYRPDWENVKVIEGKVSFSLGARAHDSKGNFVWK
Ga0208597_10135984F078719AGGMEIIEVYLLLALTTGITSCYLFLSPAVAIAKDMGIKNSFTENTWLSYLIYITITTITAPFSVLPIFIPSFAERFKTGLERAVMESQT
Ga0208597_10135985F099303N/AMTKERHDMNFIEFTYTKADGTESKRAVLPLVGPTTFVEGIDVSQMPEDEFVVFCRDFSALKSAQHEQTMAMLEQFDLKHNYRRFIPAQMSNITTDYV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.