NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208465_1000339

Scaffold Ga0208465_1000339


Overview

Basic Information
Taxon OID3300020570 Open in IMG/M
Scaffold IDGa0208465_1000339 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13984
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (73.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000369Metagenome / Metatranscriptome1222Y
F013888Metagenome / Metatranscriptome267Y
F047645Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0208465_100033910F013888AGAAGGMAIVGVLPASGKASRIGGIPKFCLPISDERSLLQWHVEQMLEVCDEVRIATRPEWVPIVQNMDMNIKLMVREPSTMSDAINFMIGECNDTVMVGMPDTYILNAPVNIYKDMTKEDKADLVLGVWECGEDIKGRVGQVLLSGNKVIGSEDKVDNCDYPDMWGTMLFRKNMIRYLDPKLDHPGKQLKDWIQDGVNIRAVKPGGRYMDIGTLKGLKQLYKEMDNA
Ga0208465_10003397F047645AGTAGMTSKKHCRHVYEYVYSTICPDCGKDTHEPDIELHSKLFKEYYESGKHLSWKCPIDGGTIRGWWSI
Ga0208465_10003398F000369N/AMDIELADHFDRMNKVVEELLKGNNPTQIATVTGFKRAEVIGYIDEWKEVVKNDSGARDRAKQAISGADQHYAMLIKEAWKTVEDADQAGQLNVKATALKLIADIEGKRIGMLQEVGLLDNAELATQLAETERKQEILVKILKEVTATCPKCKMEVAKRLSQITGVVEPVVIHDEQEAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.