NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210407_10000685

Scaffold Ga0210407_10000685


Overview

Basic Information
Taxon OID3300020579 Open in IMG/M
Scaffold IDGa0210407_10000685 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)36394
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (84.85%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002063Metagenome / Metatranscriptome597Y
F003732Metagenome / Metatranscriptome471Y
F007323Metagenome / Metatranscriptome353Y
F052847Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0210407_1000068512F002063GGAGGMIAALELTILVLITIFAVAVAAGLHWLFLKAAFLLMRPATVQRTAVRTELARGTAQLARAYSAPR
Ga0210407_1000068513F052847AGAAGGMVALRWLLMLVGAGVFGSAGALVAYDIYLSEQLRRLLSRNRTDKSGGDVRLRAARKPVRKGLTLRVNFLGGHAGQGFR
Ga0210407_1000068520F003732GGGGGMSTKENLLFLWILVMVAFGLVFHHFWASTVYALGRAVAPTLISLLGLAKIAAGMYGVHLL
Ga0210407_100006859F007323N/AMPRKLVWIDKQNLQGFGCSECNWMFKPSGAIVLESLEEMKQKYEAQRNKEFAAHVCVKHPRAARPKTE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.