NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210403_10000014

Scaffold Ga0210403_10000014


Overview

Basic Information
Taxon OID3300020580 Open in IMG/M
Scaffold IDGa0210403_10000014 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)208354
Total Scaffold Genes203 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)166 (81.77%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000173Metagenome / Metatranscriptome1777Y
F001983Metagenome / Metatranscriptome608Y
F003449Metagenome / Metatranscriptome486Y
F011577Metagenome / Metatranscriptome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0210403_10000014101F000173AGGAGGMKTFEVQFRYRDRSEKTAESTVKVEASNLPGAVGKAVREFVKGLDRKQRFDMNKNGLEITAKSGGTAETQAEAAAS
Ga0210403_10000014102F001983AGGAMTRRNAGALLATAAVLSLPLTACKDSKTLEENERLKAQVAELHKENGQVGNDLETMTAARDALKQENEKLKAELKGRKTKHPGKKAANKNTVRAEGHDGLEARE
Ga0210403_10000014187F003449GAGMFRFQYSVTTRASRARAWEIFSNWRRWNEFANIYGELHWREGSPWTAGSRLEIEVLQPVKTVVSHVITNCQPAHKVGWIDHSLGVVLAQWVSFEEAVTGGTRVHTWGDVVHSGVTIAGQTAEHLITKFTETWYENFRSACDEMAVAGGD
Ga0210403_1000001428F011577AGGAGMLFLAKAALGLGGTIVLAGAYTFHEGVIRVDVDESRAGGSHVHMWVPAAAVPMALHIVPKRHFMYTSEHGRDFVPLAYAIVKELKKFPDAELIEVDDGTQHVRIRTHEGKLQIDETEPGQDVHLLIPLSTLEDVTSQLEANAPSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.