NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210403_10001124

Scaffold Ga0210403_10001124


Overview

Basic Information
Taxon OID3300020580 Open in IMG/M
Scaffold IDGa0210403_10001124 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25968
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (84.62%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005788Metagenome390Y
F012474Metagenome / Metatranscriptome280Y
F058327Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0210403_1000112418F005788GAGGMTPKQFQKSNLALELKTGKKRLEGALHGLSEEQCETAGATRSGSVVDLLSEIVTKEFVALMEISDRLPSLPMNLLANVDGRTPTASGTEKATANNSINNLLAEFSFLRAAVVSRVDDGGSDGAEFNAKYAYITDVCVTKFNEQIDEIERWRSSEIVGFSAARLRAEAREVELNQAIVDLSREDFLAGMFDLKSLFSVLFDRFYSEDIVQWLGAVESNGRAAMFQRMAAALEPMHTLLEMGLASIASLRVTATAQDAEGNFTTDWETVFGGAYSTGAAVRWRTVRAWKSRKVIAERIEDLP
Ga0210403_1000112424F012474AGGAGMTIRHFVGTVLLFGVLICLTVGVESVAAQGPAGAGAAAVAQDSSHSLHSVNPVTWIKKDSKNSTDTPGSRTGAEQKLTPSLQAQGVLAPTTTLTDACAPFTALDGCLAALHASHNLGVDFNCLRADATGVHTGADVSGCKVADGEKAQGLNKAVHQLKPEANAKQAAKDAEQQAKDDLKGIGL
Ga0210403_1000112426F058327N/ARAAILELDCSLLKIRLKAAEDAINARASDARASREERREMNDALSTLRRLKKVDR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.