NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210395_10000300

Scaffold Ga0210395_10000300


Overview

Basic Information
Taxon OID3300020582 Open in IMG/M
Scaffold IDGa0210395_10000300 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)38780
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (81.58%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000549Metagenome / Metatranscriptome1036Y
F001500Metagenome / Metatranscriptome682Y
F060175Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0210395_1000030021F001500N/AMPNPNPLAGIVPRVVHPVNDGETTITEYIEKIEGEVALDTYVKAQTSAPEVVKRLTELENCLWRMANAVLSLSDVDRHPELRAAVEEAKLVLKNRLEVDDTKHRFHSELGVFKDE
Ga0210395_1000030023F060175AGGAGGMRISRFQVISAVVLLLVALSAASRAQDQKSPSQEDRQKAINLVRAINTAEVLYNVNISHGRFASWTELYDSGLVKELQVSPSSEVIPGYHLDLLASPDGKSFMIALHDTKDGDGLFSVFSDQSGILFLGAPPQ
Ga0210395_100003005F000549AGGAGVQPQGQKKVARGYRIEGSIVLYRSAARSQFKAERTLIRPEPRWTMVFGVPLFVRTVLRLVFVCFHRHKSPPIRLRGSASSQPGFRSVGSLGTYVTCLDCGQKFAYNHKTRRFVDFWGIRDAEALAAVRRKIDGFFTPLRGLAARVGRNVRILSSQLVRSVHDLAILTKGQQNKSRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.