NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210395_10003192

Scaffold Ga0210395_10003192


Overview

Basic Information
Taxon OID3300020582 Open in IMG/M
Scaffold IDGa0210395_10003192 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12598
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007124Metagenome / Metatranscriptome357Y
F019342Metagenome / Metatranscriptome230Y
F028285Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
Ga0210395_100031921F028285GGAGLPTKKHLIFHVVWRGVNLLLVAVMVSSVYAGVREYSVRRYLDGFSDAIVPNALPEEQKLNAILSWMRAEPSRATSANPEALAKRDPETTLTYSQLLNVCGT
Ga0210395_100031925F007124AGGAGMKLYCGLFALACVPAALAGNNAPLPKDNLAEFVAQKLDVTTLPLSIRPKPQKSKKTFSDYGYVMQQMDDKQKLIETTSEGSQINIRILEQNDSGVYVCVQSPGQTPQTGPVQRVLLLKLKDTNGLLKARESWKEFSGCPVLGGDSPDSPSGSYGG
Ga0210395_100031928F019342GGAGGMHKRFILLFGVFLGAYAPMPAQTPAPQIVPAQERIATIVTLVRTVPTLPSLGPSLPLSESPRKSAATFGYMLAGVYPRQDSLASLSPVHEVKTLFLTQSILPLVSVWGGRLRLAGFSSTLDMKNVQLGPSMAGGLLDYRPPRPSYPGGPRSVGLYGANLTFHFGRDAQTGRPDQIWRTLARIARAAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.