Scaffold Ga0206126_10129887

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0206126_10129887

Scaffold Ga0206126_10129887

Overview

Basic Information
Taxon OID	3300020595 Open in IMG/M
Scaffold ID	Ga0206126_10129887 Open in IMG/M
Source Dataset Name	Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1216
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location Name	Atlantic Ocean: North Sea, Helgoland
Coordinates	Lat. (^o)	54.1841	Long. (^o)	7.9	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041607	Metagenome / Metatranscriptome	159	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0206126_101298873	F041607	N/A	WKAIMQTISKRIYRIEASRPSMPNPKAEKALAAIIEYLDGLALRKSSGDPNVQEEIEAVAKILTGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.