Scaffold Ga0213500_10016904

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213500_10016904

Scaffold Ga0213500_10016904

Overview

Basic Information
Taxon OID	3300020602 Open in IMG/M
Scaffold ID	Ga0213500_10016904 Open in IMG/M
Source Dataset Name	Leaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1049
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. CR1	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.6622	Long. (^o)	-119.6197	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011735	Metagenome / Metatranscriptome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213500_100169042	F011735	GGA	LWLGPYVVKRVLQKGAYELVDFEGIPLVEPINGLYLKKYYA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.