NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213500_10052038

Scaffold Ga0213500_10052038


Overview

Basic Information
Taxon OID3300020602 Open in IMG/M
Scaffold IDGa0213500_10052038 Open in IMG/M
Source Dataset NameLeaf-associated microbial communities from Abies magnifica in Yosemite National Park, California, United States - Redfir_Yose_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)755
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Above-Ground Endophytic Microbial Communities From Plants In Different Locations In The United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.6622Long. (o)-119.6197Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065766Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0213500_100520381F065766GGAMEDENRDDGAGYLIKMFLEEALTQQRNEMMDNFTQILRRMLAATKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.