Scaffold Ga0214256_100690

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214256_100690

Scaffold Ga0214256_100690

Overview

Basic Information
Taxon OID	3300020685 Open in IMG/M
Scaffold ID	Ga0214256_100690 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 hypolimnion
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	4395
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.041	Long. (^o)	-89.686	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026473	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214256_10069010	F026473	GAGG	MAYSNTTGNTTINVDQLISYAYRDAGKTAEEVTPEYVEAAKQALFYNLQNLSNRGVNLWLLENQLYGVLTQQQQLVLPKTVIDVREANWVYVQNIQASEYLPADNPESPAAFDLSPTLSTPASTLGYANYFGSTYQQSQSVYYVGWNAYAPNTTQTYNLAFEYSDDGVNWFLKEQFPAITMSDYEWQYYNISTTEPHLYWRLRETVASSYSVRQV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.