NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214238_1003297

Scaffold Ga0214238_1003297


Overview

Basic Information
Taxon OID3300020707 Open in IMG/M
Scaffold IDGa0214238_1003297 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2622
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029972Metagenome186Y
F058633Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0214238_10032975F029972GAGMGKFQQKFSQRQEKELEAEWPLAHRTVGSGNKWEKGDLSTEEQYNISFLVEAKATQAASYSITKKVWDTIKEHAQNRSWLTRPILAIRLYGPTMEKTNWGGERENTPDTLPVELDLICMDKNDFLELYYDYLRLKEKE
Ga0214238_10032977F058633GGAMSFLERTLAAYQNDEPITKYIEEALMKGNIFPEEYPVKVFNKERVFDNMYHPSSDVSAGELQLYYKFHPEERLLLQEERISPTLAMTFQVGSVFHSVVQNLLIHLGFTTIDKVEVKFKNEERMIAGAVDVLELTTPDGEKFLVDIKSTNQLPKEASYQYAMQLRTYQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.