NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214255_1006359

Scaffold Ga0214255_1006359


Overview

Basic Information
Taxon OID3300020712 Open in IMG/M
Scaffold IDGa0214255_1006359 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1700
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010226Metagenome / Metatranscriptome306Y
F021290Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0214255_10063592F021290N/AMRAREFICELKGHRGKGRSAPAPEFERAHPGIIGPSGRGDMYIGRYYDHYRISSLAGMHPDDIANIDEVSFFGNMPIFSGYTQPERDKLKAIMKKLGMKPKDYISTGSHEPDDTNHTSPVTGFKGYK
Ga0214255_10063593F010226AGGMAIQVINAAGNVLWTTDKAEIDSNSADVTYQVFATGLGNAAPVGNLYANVVAVPNGTVRDIYVGSGNYLIMTGTTFTARALGTQSSAQHSVFNSSGV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.