NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214207_1002409

Scaffold Ga0214207_1002409


Overview

Basic Information
Taxon OID3300020716 Open in IMG/M
Scaffold IDGa0214207_1002409 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3733
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005167Metagenome / Metatranscriptome410Y
F009741Metagenome / Metatranscriptome313Y
F025484Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0214207_10024091F009741AGGAGMTQSFDGNYDYTKPWRAPIQPDQVAKKWSYNGPWSTNMERLTSQALMVATIPGADIQAMVRPPLPQIQLFPERFGYGPSVQPGIEDVVSVDRNYHEPRVSWYSGSPAGYSGSSRNDLGTN
Ga0214207_10024092F025484GGAMFDGDGAETMELQAKKVMQNAMEYRGSAPCPTCGVIMNPVEFMYNQGKCLNCLTQQKASRIKGKMV
Ga0214207_10024093F005167N/AMNQSLDEGATDGKYRKVRPNTTVIPGLGNEETMRNREALHPFSGYGFITSEMPNKVNPGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.