NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214202_1004766

Scaffold Ga0214202_1004766


Overview

Basic Information
Taxon OID3300020728 Open in IMG/M
Scaffold IDGa0214202_1004766 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3116
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026196Metagenome / Metatranscriptome198N
F040464Metagenome / Metatranscriptome161N
F043229Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0214202_10047662F026196N/AMWPTRMSEPSNSCNNITFSCEKNTIGLNQPNGKYFTSLGLWQRRDKLVEELINLINATKVNKSEADSIKIQEYSKIQSIIEEQREIDPEWHLIIRQQGEGCLRVSHYDCYCNSGNDSKCSHNAVPLVKPRTLRDVTEIVKSIQETMNAINTNISFDENIGTMMKLYFFIKELRRVEPNRLPCLREVSRNSSKESKA
Ga0214202_10047664F040464N/AMNKETINYKNKVYTFKHRTMNPTVSPEWLRRGYAFVGQTQEHLKDILKELTLKMRTMTDKEIERHLRRGLKVTGDITLELSRVVRQGLEQKRTFKGLLGTLIETKNWALIKLILEVTEELKERSSSSSLLFSIAKEILRELQRIQAIIPIKELKQMETSLIDIQYWKLTRHLRI
Ga0214202_10047666F043229N/AMTQKGVKLEIETIEECGCEPHECYCRHNKEYKKSMKIRNLTTMIGLIEADAPLSFRALERICDLKKKIKRIDPEWILVNEVKLLEHQVLSQLDTIDHTIPWNSARNKLRYIELCQSINKLKIIHPDWEMDLEDSKNHYICRCCSCLEKRKMYQQTLDETRLEKSTPYKESRNKFSN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.