Scaffold Ga0214090_10718017

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214090_10718017

Scaffold Ga0214090_10718017

Overview

Basic Information
Taxon OID	3300020816 Open in IMG/M
Scaffold ID	Ga0214090_10718017 Open in IMG/M
Source Dataset Name	Food waste microbial community from Durham, Ontario, Canada - FW1 megahit
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1194
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	Durham, Ontario, Canada
Coordinates	Lat. (^o)	44.1763	Long. (^o)	-80.8185	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011735	Metagenome / Metatranscriptome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214090_107180173	F011735	N/A	IVKHVLKNGAYELIDYEGVPLVQPRNGLYLKKYYA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.