Basic Information | |
---|---|
Taxon OID | 3300020817 Open in IMG/M |
Scaffold ID | Ga0214258_10361003 Open in IMG/M |
Source Dataset Name | Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahit |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1323 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Toronto, Toronto, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 43.6629 | Long. (o) | -79.3957 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004815 | Metagenome | 422 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214258_103610031 | F004815 | N/A | KARLDVALGSLGCWLATLHIAGGWNWMSTVLLFNPGHCVNTF |
⦗Top⦘ |