NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0215015_10293144

Scaffold Ga0215015_10293144


Overview

Basic Information
Taxon OID3300021046 Open in IMG/M
Scaffold IDGa0215015_10293144 Open in IMG/M
Source Dataset NameSoil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Colorado
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2289
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us

Source Dataset Sampling Location
Location NameHuntingdon County, Pennsylvania, United States
CoordinatesLat. (o)40.6949Long. (o)-77.9199Alt. (m)Depth (m).9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016387Metagenome / Metatranscriptome247N
F022177Metagenome / Metatranscriptome215Y
F049864Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0215015_102931441F016387GGAGVTLAPIRTTFELKPTPVSSSRSVTRTLRLDEDVEAGIVEMAEREQFSFNLLANRALRKLVEWEDKATKFGFIQVPVSIVEKVFSILSDEEARELGREAGTNTLPEMVLFWFKKFNPETALKAMEMIGSYGNAFRLQYTLDGETDTVVLKHDRGPRVSAFYSELVQSLFKPMGAKVETRETDGQVVATIIRPAMSFVGERREAPLIPSFVGAKNGRGYKR
Ga0215015_102931443F022177AGAAGGVKDARHSILENYSWTAFLRLKGQTWARRQEEILDEFDGFVQSLRSAGVDYNIIVKVKGKAPRQLDSDYHTRETAHKLARDASSA
Ga0215015_102931444F049864GAGVHNKMAKFILSMGDGTFKKLETEAKKRDVTVQQLLRAVIVPEWVRENIEQNAPLLAPREIAPHSLHQSIYPSQRDQILQTPVNRLKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.