Scaffold Ga0215015_10386537

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0215015_10386537

Scaffold Ga0215015_10386537

Overview

Basic Information
Taxon OID	3300021046 Open in IMG/M
Scaffold ID	Ga0215015_10386537 Open in IMG/M
Source Dataset Name	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Colorado
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	838
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us

Source Dataset Sampling Location
Location Name	Huntingdon County, Pennsylvania, United States
Coordinates	Lat. (^o)	40.6949	Long. (^o)	-77.9199	Alt. (m)		Depth (m)	.9
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013122	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215015_103865372	F013122	GGA	MPDEHFQLEADSTVRAWLEAHPSKAPRVIAYDVHRCCGGGKICQVKVRELSQKDDPSQYVTGVMDDGTRFLIDRRAAARLPSRFGLTVRGLGRLKHLDLDLAGEQWGTLLYD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.