Scaffold Ga0210242_101880

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0210242_101880

Scaffold Ga0210242_101880

Overview

Basic Information
Taxon OID	3300021047 Open in IMG/M
Scaffold ID	Ga0210242_101880 Open in IMG/M
Source Dataset Name	Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States - P5a_16mM
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13868
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Washington
Coordinates	Lat. (^o)	47.6519	Long. (^o)	-122.3113	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057909	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0210242_1018806	F057909	GGA	MAFAEKFAARAAASLTEEDKARMAELEARGKERRWTHGPDFLFDLGKEATGGVTPYEMKDARETWYSKQRIKKLDGGQRNCGGVVLSSHAVGDNLIGYSDWSKPEFARQPIIRDSFFRSTGVLRDPTPANI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.