Basic Information | |
---|---|
Taxon OID | 3300021058 Open in IMG/M |
Scaffold ID | Ga0210248_103867 Open in IMG/M |
Source Dataset Name | Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States - P3_32mM |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5777 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Chrysochromulina Tobin Associated Microbial Communities From Unialgal Haptophyte Culture In Seattle, Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 47.6519 | Long. (o) | -122.3113 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104622 | Metagenome / Metatranscriptome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210248_1038671 | F104622 | N/A | VPMILMGWDNLVRPPLKMFLKGEGGTLETLYLMFIALLLIPVSIAQTMFGFGGGNTDMAMAVVGAMDMVAGDVAATADETAEEEQGGGEGAGAVGRVEEGVRG |
⦗Top⦘ |