NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194044_10079244

Scaffold Ga0194044_10079244


Overview

Basic Information
Taxon OID3300021074 Open in IMG/M
Scaffold IDGa0194044_10079244 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1341
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.775Long. (o)-93.818Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045503Metagenome / Metatranscriptome152N
F098576Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0194044_100792441F098576N/AVFLRRVEVPVPAPVEPLQTKGVSNPRHFVVTHSHRHGVTTGLVIGQKGQRKPTPAESIKLLQLDFEPDREEFVEVTEVAPVFLSKPRRNPETTGGERARLIAQWAGRLYDMTASWQGPIGMQLAYLFAAMARGSHVALKRHSALVRLLRQEGVPTSDPIWKYIRIEE
Ga0194044_100792442F045503N/APAPSNQRVREIQQWLGTYGGSVANAYVVNAGALRELGAERGILEKILWRVPRDKPEMPLTGEAMMELLAPKRLMREVRKQLKLDTQEHHAHTKAFEQSRQQLIASKIPADAQNREAVIREVESWFKMVLPEMRNTKAILRATELRLEARRDIHPVLPPLRATTELVEQLNKREPGRVYIDKDGGELLLLKPGEQAVLNEKGLRIENGAPSMPAPDMN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.