NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206677_10000713

Scaffold Ga0206677_10000713


Overview

Basic Information
Taxon OID3300021085 Open in IMG/M
Scaffold IDGa0206677_10000713 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31619
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (82.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063096Metagenome / Metatranscriptome130Y
F070577Metagenome / Metatranscriptome123Y
F071667Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0206677_1000071310F063096GAGGMRIIEVNINEVKNFRAGFELVEYENGTDPMDGFVLLGFDEVGQFCKEPKYAFIGE
Ga0206677_100007134F071667AGGAGMRIIAIAFALVLSACSTVDATIDGTGGVIKGVGSDVFGVTAGVLDVTSNLIKDVADKTGTAATKPEEE
Ga0206677_1000071342F070577GGAGMVKKFEMVQGRKSEKDKILLFYGHAIAFEDVAKICIFFMGNEDNLYPPSKGLKGAEMFKDYIKEVLETRRVPTDSKYAIRKNHGVVKVNG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.