NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206677_10004204

Scaffold Ga0206677_10004204


Overview

Basic Information
Taxon OID3300021085 Open in IMG/M
Scaffold IDGa0206677_10004204 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11848
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (21.74%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F013232Metagenome / Metatranscriptome273Y
F015402Metagenome / Metatranscriptome255Y
F057685Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0206677_1000420419F015402N/AMGKTKNYLGSLDLNEEELNQELYSRGDEEYQYQKWIESKEFAEYVNAELDSTRPRYSEQDISSATRYASEHITIDPSEVGKEVYDMLFSEKIEEYLTCVSYS
Ga0206677_1000420420F006200AGAAGMANKKEDWLETLVKKYSIPTEEKTDKRGILNESQLKNLKDGKN
Ga0206677_1000420421F057685N/AMKSAVDSSWTCGCGSLNAGWLTTCGGCKEREIMANKTPKTDLLKILNTIKEDFEMLQDGSWDLRYSDGTEIEASLDNVDKAIKIVNKEVHGK
Ga0206677_1000420422F013232N/AMSDREIMNAKSGVPMWWKPGIAFLKQDWINHPHLKHFRNKKSTDSKCDCSSPKLVELWEHDSCVRGRIDTTVCVKCNEVESLSIVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.