NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210404_10844543

Scaffold Ga0210404_10844543


Overview

Basic Information
Taxon OID3300021088 Open in IMG/M
Scaffold IDGa0210404_10844543 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_40CM_2_52_4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042845Metagenome / Metatranscriptome157Y
F046962Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0210404_108445431F046962N/AGYIKTRGLFIWNDMEEMANSGYPPETTNQTIPQDTMTDGQLKNLLAELISSSASLNVRVWLDGVYTDIENAGAHREWMKGREVYFKVEGKVDGQNSLEEASLRGV
Ga0210404_108445432F042845GAGMKGETTVNSTPDILAEFKAMVEYLKSSRIDYSIVVQVEADQSERSRTLAMEQPRSR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.