NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194133_10177665

Scaffold Ga0194133_10177665


Overview

Basic Information
Taxon OID3300021091 Open in IMG/M
Scaffold IDGa0194133_10177665 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1464
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.8915Long. (o)29.586Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F031384Metagenome / Metatranscriptome182Y
F047643Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0194133_101776651F047643N/AGYQRCNIPRMGIMYYKLCAPSGAACMAAYWEAEFLGLDPYWLGQNVFEIGTGNNEKVTSLISKHKLDILVESDYQPTGYGRQ
Ga0194133_101776654F000450AGGAVGDRANFVFVQPGGDTIVLYGHWAGHNMLANLAEAVAKAQPRWSDPSYATRIAISNMIGDGWTFETGWGLTVNQISDNEHKIPVIDWEQATFSLHEEDSFYNFDNKVRGMKNSPLFTMDLRAFIEKYTDSPILV
Ga0194133_101776655F031384AGGAMPNWCFNGLTVEGNPDLVNDLVRIMNRPFVMIHDNWNMETKEMEVTQTTYPNPVFAFHNIWNHR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.