NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214208_1005216

Scaffold Ga0214208_1005216


Overview

Basic Information
Taxon OID3300021117 Open in IMG/M
Scaffold IDGa0214208_1005216 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 21JUL2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1393
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007918Metagenome / Metatranscriptome342Y
F036561Metagenome / Metatranscriptome169N
F042163Metagenome / Metatranscriptome158N

Sequences

Protein IDFamilyRBSSequence
Ga0214208_10052161F042163N/AMHLTVKITEQVEKKLEAVLKGRYDNRTIWMYYKVSLQVLRDTIENLIACHHTTHPLAEKDLYYEQNKVQIVDWI
Ga0214208_10052163F007918N/AMSETTVEESDPFSKQEIEEIKQELLSILANVESVTEAMNRAVLKEEDRREQFRTLCSLIDHSFGENIEMIEKRKDDLKKIDPSLQAIDYKLSTRMERLREVAIKSDLKSMKIEMEKVLSQQRIEKFQTNPQQEEQRPQKG
Ga0214208_10052164F036561N/AFRSLLVSVEQTLSTSMRRVHRKVIELRKENSKISKEVLELEFDLERIREVVMSPNLEQMRTLIEDIYDWKVYKQSRSEKEIEDLQSTTVDEKKIDSPESLVT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.