NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214165_1003299

Scaffold Ga0214165_1003299


Overview

Basic Information
Taxon OID3300021137 Open in IMG/M
Scaffold IDGa0214165_1003299 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6876
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016785Metagenome / Metatranscriptome244Y
F070626Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ga0214165_10032991F016785AGGMLFKQNLVVENLASPSGNRGIAEKVCHEAYMKMVDYLRLTQAKNTYNRFTDYHYLNIPVSESTEPIRGLDYIHPIVTPGIDYATAVITKCLMPDGKVNFEFERFDESDQDGAEQATDMVKYFLNNKNNSYMTIRDWAQDALLHKNGIVMVMPVRENIIQYKEVTGTRDQLKVFEIEAAQKGLKPLRQEMRKVDVNLQQAMMEAMQPGDEQETEQEVDPGAELNEAIRNNTVYRAKYKLTGTKTNIRIKHVAQHYFVCNPTIPQIMYQDFVGFYEPMTIHEAKVQYPFIDMEEFADHAAYGPAGAY
Ga0214165_100329910F070626AGGAGGMEIEWSLAHPLHDVEDIVNMADNIFGDEVEDILTTERYIFRKNVTVASTVQIFDRSKEFLAVARIGNISGTGEFSDKLLGFCWFDRYGYTTYSNEEISNAKFHHVDLALPAKTRVKLINAMIDQHILWAYQNGIPVVCSTSIRSDHSGFMRIHEKRGFKVSGSYAWIRTKEGLNGIKGIEIANN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.