Basic Information | |
---|---|
Taxon OID | 3300021139 Open in IMG/M |
Scaffold ID | Ga0214166_1025227 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1456 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Trout Bog, Vilas County, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 46.0412 | Long. (o) | -89.6864 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000324 | Metagenome / Metatranscriptome | 1299 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0214166_10252273 | F000324 | AGGA | MTTPITPAHSFVYDGARMNIFHVNKGEGLPKHEHNFAHATFCMSGSCYIRKENKEIIADKFTQPVNLVANEWHEIEAAEDGTVFCNVFAEGKY |
⦗Top⦘ |