NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210388_10012293

Scaffold Ga0210388_10012293


Overview

Basic Information
Taxon OID3300021181 Open in IMG/M
Scaffold IDGa0210388_10012293 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6834
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011101Metagenome / Metatranscriptome295Y
F011163Metagenome / Metatranscriptome294Y
F085999Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0210388_100122933F085999GAGGVYRMIIKVNAMKTILRIRTVTCVVLAVGALLSTPGAVASDSDFYPSYLQAKVIAHLPLSGGARRMFSLQEGGRQFLYVQQSPQQGVTVIDITKPERPKVVNQVHLENLTIVSFGLAISETPKNPATWGASLGDGNAEGSPGDDALESVRVLDVSDPAHPRSVRDFDGVTSILQDSVRNLLYVANGAGVWIVSHQQVLRSHECSSSDTISPLPNCD
Ga0210388_100122934F011101GGAMTYRAITFASAALFVTSLALASDTWVLDSNRSNARIFRGSRANSESVNTRVARVTGKVKLDANDLDTSFFDLSIYPADGNWGKALSPEGALPMGYAPDSTDQILLTFTSTRIVRAENGRLEVVGDLTLTHVGRNVTAMPTEAYAGPVYGDPVIHNVTRGITFLFPSPSAANLSESLTPAVQQTRGVLEVEGAARVEREEFPELLSAIEDTNWPSVVENEHCQASYSGGGEGYSGPVCTGALIAATQTDNCQATYLGGGEGYSGPACASAAGNQTTIVLDLKFLHKVPEPSVEAHSGKGSSGNAAPGRLNGSSN
Ga0210388_100122935F011163AGGVGFGMEILFVLMLGLLVLGPKRLHTLLARVARAKAELENATRGLKSQLAAELDAASGAGKTDCSHVLVGDRDLCATFKTVPESREAAEDVLMGN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.