Scaffold Ga0214544_1001190

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214544_1001190

Scaffold Ga0214544_1001190

Overview

Basic Information
Taxon OID	3300021320 Open in IMG/M
Scaffold ID	Ga0214544_1001190 Open in IMG/M
Source Dataset Name	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	52873
Total Scaffold Genes	37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (43.24%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.06	Long. (^o)	-118.44	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013985	Metagenome	266	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214544_10011904	F013985	N/A	MVAPNMLDPFFADIVAVFLGNAWQTNAVNNSVTFQGTRNSTITFLSAPNASIVIEGQIGVTFYLPPTVQVNPIHNFFPPPV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.