Scaffold Ga0214543_1008797

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214543_1008797

Scaffold Ga0214543_1008797

Overview

Basic Information
Taxon OID	3300021327 Open in IMG/M
Scaffold ID	Ga0214543_1008797 Open in IMG/M
Source Dataset Name	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16235
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.06	Long. (^o)	-118.44	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033327	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214543_10087972	F033327	N/A	MKMQERKVREERTPRDFYTGSLKPELHPVCQGNLSLTLHYFKSFTKYSPLHFQNMQKHHKRQLNHTRITPAQQEPSCRPGKPPNTHTKLEKGQTSMVAKPILPQTTFFKVQTKPKAPRIDPRSIFNSCNTYDHKGESFHKFSEQICALK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.