Scaffold Ga0213867_1000504

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213867_1000504

Scaffold Ga0213867_1000504

Overview

Basic Information
Taxon OID	3300021335 Open in IMG/M
Scaffold ID	Ga0213867_1000504 Open in IMG/M
Source Dataset Name	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17473
Total Scaffold Genes	35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (88.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	34.7181	Long. (^o)	-76.6707	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068251	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213867_100050433	F068251	GGAG	MTQKIDKPMVMVSCETLEDLHLAAYSHDDVTYPVTGEYVKQAQEEARQALYSCGWWQQGDED

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.