Scaffold Ga0213867_1000915

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213867_1000915

Scaffold Ga0213867_1000915

Overview

Basic Information
Taxon OID	3300021335 Open in IMG/M
Scaffold ID	Ga0213867_1000915 Open in IMG/M
Source Dataset Name	Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13154
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (56.25%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	34.7181	Long. (^o)	-76.6707	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034000	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213867_100091511	F034000	GGA	MTDQHPPMTRQQQLAALFAQLQELTTKEERQDYPFWDHLNDLINDLEMEEDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.