NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206692_1703269

Scaffold Ga0206692_1703269


Overview

Basic Information
Taxon OID3300021350 Open in IMG/M
Scaffold IDGa0206692_1703269 Open in IMG/M
Source Dataset NameMetatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)851
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051139Metagenome / Metatranscriptome144Y
F061271Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0206692_17032692F051139N/AMQKAELELPVKQFHQLYDLLGDILDHETGTYDFNMENSDIELIEDIRNELFNQIPDEEPAETTYAFTTAISGHYITPLRLYKIKRCSDHGSGFLITNDRRSEVYCIENGCSHLSPDQSENWNLTTITNN
Ga0206692_17032693F061271N/AMQELDKVEHQWCDDNDRWMYIEYDRDGKVMGLNFMQGDEYECFKKDWCVSDKGLTAFYKQMLYTFAYEQGNVPEHCFINSCMWAYHAAISEYEHNNCEIGNATKC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.