NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213863_10103806

Scaffold Ga0213863_10103806


Overview

Basic Information
Taxon OID3300021371 Open in IMG/M
Scaffold IDGa0213863_10103806 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1356
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F013703Metagenome / Metatranscriptome269Y
F050304Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0213863_101038061F050304GAGGMRFKKYYKDILSLVGAVLLLGTTILINKYDVKQLYREFVGLRLKVDAQEKQIEGLEDKVSVLIVQNQRLLKDLEQHNETRGSENALLMTRLYELEQQVEILS
Ga0213863_101038062F001319AGGAGMKKLWSIAILLSVVFAQLPQPTLVGQDDLQVPTLSINNFVNQAEIEGLEDSRVFLGITNILTENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0213863_101038064F013703N/ADNTINLQTFVSYTLFRYFEGLKTENKYLLLESPILIYPGASIDINFTETFKMNFGFNVGYNTLVNDLGERNISYSIVFGTNF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.