NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213865_10039947

Scaffold Ga0213865_10039947


Overview

Basic Information
Taxon OID3300021373 Open in IMG/M
Scaffold IDGa0213865_10039947 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2619
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004343Metagenome / Metatranscriptome442Y
F008887Metagenome / Metatranscriptome326Y
F043377Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0213865_100399473F008887AGAAGGMNRGCCNECGYKADYIIDNNNYADNGYKDLNQVPKDKMLCGVCYEENEDDS
Ga0213865_100399475F004343GAGGMTQYKDMIDQARQLLRTEQENIPSMSKDFSKDYWLLTYPCGKIVKTYQDKRKKDVVIQESYNGGK
Ga0213865_100399477F043377AGGAGMNETLNEIIQDLADLGYTALDLKEDITTGEPSVQTALEKINKIHQVLIFNQDKLIELTKGEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.