Scaffold Ga0213881_10019113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213881_10019113

Scaffold Ga0213881_10019113

Overview

Basic Information
Taxon OID	3300021374 Open in IMG/M
Scaffold ID	Ga0213881_10019113 Open in IMG/M
Source Dataset Name	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2832
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location Name	Brazil: Minas Gerais
Coordinates	Lat. (^o)	-19.28	Long. (^o)	-43.5919	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008629	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213881_100191133	F008629	N/A	NSESFAGMVSRGALLKTSGIVYALHHPAGLHDPAAWNSGFGYLVTTGVAPVVDGEWTNYEPAPTSSLTPPRTSCWPDAPVKVPEYLRYLAAHGIGLNVYQLQPGYMIKSYANMADPTTINGRTWSCLSNHEPQPGQGAGSLVMAWFNQQNG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.