NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213869_10020895

Scaffold Ga0213869_10020895


Overview

Basic Information
Taxon OID3300021375 Open in IMG/M
Scaffold IDGa0213869_10020895 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3703
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (14.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015096Metagenome / Metatranscriptome257Y
F085719Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0213869_1002089514F015096GAGLYINHRDEDNMNYRTEWQARQKELEDKYVELMLAKYPLLTDVTTDTQRKNDTRMFELNHKKYGPTRFATYKTGMVRKIIRTRFGELSCYQLNPQRKSIRYYVHLSDNSELNVKSYEGIERVGISNGLARLVYLEKYLIKNYNLDSVQDIIEVDGVLYKKI
Ga0213869_100208953F085719AGGVKYLQELTFINQLMVMTKTYRNIEYTYMISETWNGIKYDNYHCNDRNLLDGLDTVSFTKLSEQDMRDEIDHLIDQRQDLLQIQNLVHEARRDWYTNTYSGEYTGD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.