NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224422_10048186

Scaffold Ga0224422_10048186


Overview

Basic Information
Taxon OID3300021400 Open in IMG/M
Scaffold IDGa0224422_10048186 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from New Zealand - Tag 1265 SPADES assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)412324
Total Scaffold Genes614 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)161 (26.22%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location
Location NameNew Zealand
CoordinatesLat. (o)-42.26Long. (o)171.6Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028722Metagenome / Metatranscriptome190Y
F057815Metagenome / Metatranscriptome135Y
F063246Metagenome / Metatranscriptome129Y
F072887Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0224422_10048186205F072887N/AMKLKTDNMEKCMRCGHELIIGGNFMLSDFNGEDLAEEDDAMVTNAHCPYCGARYELYDTPESEKKNYPYWSN
Ga0224422_10048186369F057815AGGAMAKKIKDSDILKAMVMHLDEDSVVFGANGHYAVGAYYDITKVSSVFGDKDYNSQDNIDAADETKAAELYRTNNDELDEGFQKAEWLKNY
Ga0224422_10048186385F028722N/AMANTVQNGQTCLEKRGMEERHQEITRSDYNIENQYGPTHPDAISDGDAQGKGTGHGGHTHFLPDCTKPTTQINYSNFDTENGGGYYDIKGRNGISGRERALAISMYNKETPYGANLVDTTQNVNDGQYFFGQQIGQKTTT
Ga0224422_10048186409F063246N/AMPRFKIELNDVQNIRDLLQSAYNLADEQIVQAQNEINKLSVSTQLEQEAMDAKSKYAKAINDYLGMKDKAISKKLDIAKILTDIYHHNGDVKSAMENGENMKNMDFNFDDIKKMIDESYEEKDKDKTKTIELNKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.