NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210393_10000008

Scaffold Ga0210393_10000008


Overview

Basic Information
Taxon OID3300021401 Open in IMG/M
Scaffold IDGa0210393_10000008 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)309871
Total Scaffold Genes293 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)228 (77.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001177Metagenome / Metatranscriptome756Y
F002209Metagenome / Metatranscriptome583Y
F034634Metagenome / Metatranscriptome174Y
F055867Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0210393_10000008148F002209GGCGGMNRITPREFRNAFIAVMQAEHDNFRTAVGFETKSYNFFMRTTIYPRVGRQLGLLSWNREYYTLDGMLYEERGTDETGKYATYANWISVAIEHENDSTRAHEKMNKLQAFNAPLKVLITYAAEGSASEALLRKYENLIKTSDVFHDVATLRQQLVILGTPKTVREWRFYAYENDGFVLMLP
Ga0210393_10000008196F055867AGGAGMHTHPPIDPDDPGGTSGEEVREPPLPGTQGTPREEFPRKGDLVDPEPAATNK
Ga0210393_10000008229F034634GGAGMSFLTYGVFGLTAISSLAGFVFNLLTGNPDTALLCFVGVGGSAAIGWMFTTWRRA
Ga0210393_10000008245F001177AGGAGGMAIKRPTKAKGTPSHKPVASAPLRHVDVRAPQQMVAGEVYVGWLCKNRSCGRVIAIATTAPGGKALTDFEDQLTAIKCPHCGNEDLYRWSARSEQNYTPKSDST
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.