 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300021407 Open in IMG/M |
| Scaffold ID | Ga0210383_10169628 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1860 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Massachusetts | |||||||
| Coordinates | Lat. (o) | 42.481016 | Long. (o) | -72.178343 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001015 | Metagenome / Metatranscriptome | 805 | Y |
| F042986 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210383_101696281 | F042986 | AGGAGG | MSDPLDVHRILEHCMQTIEAGREAMAHDMHDAAMRLGTAEMMLASASHAVHKHAAALPQVQTQPGSGAEQGGEGT |
| Ga0210383_101696282 | F001015 | AGGAG | MFAHLTRQGPRAPAGPALGPGSFRRIVDVPFETCVTELDSWQQAEQGGEVRFGDSLLCGPAERDPGSATYRIQVRLARGALRPLLRMRIDIDRWSSSSTALELIPAGHVRPTTAYFRAGHLLLDLLTRHLLQPSPPAQVRDTASRPPAPVGAGRP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |