Scaffold Ga0193695_1000387

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193695_1000387

Scaffold Ga0193695_1000387

Overview

Basic Information
Taxon OID	3300021418 Open in IMG/M
Scaffold ID	Ga0193695_1000387 Open in IMG/M
Source Dataset Name	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6723
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (18.18%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9137	Long. (^o)	-106.8949	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074703	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193695_100038711	F074703	N/A	IERIHAAGNRACVVHIDEQVLAAYTTEFSVVSTPDQLADCDAVVVVSWNVDLPLRDLAAEQFPRATALQAYYPGVVLER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.