NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210394_10000093

Scaffold Ga0210394_10000093


Overview

Basic Information
Taxon OID3300021420 Open in IMG/M
Scaffold IDGa0210394_10000093 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)218102
Total Scaffold Genes203 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)146 (71.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000552Metagenome / Metatranscriptome1033Y
F001986Metagenome / Metatranscriptome608Y
F019865Metagenome / Metatranscriptome227Y
F023916Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0210394_10000093137F023916GAGMLSPARLTQLLTEFIFLLLGALVMWLAANGRIYFDRHGVSWLVLSVALIAWGLLALAKPGLFRAKWQKWNRGGSLVLLGIAMLSISRVPFDWVVKLLAAAGLILLVRGILGSLLILWQR
Ga0210394_10000093167F001986N/AMRYNVFAQRGGAAYGVLVCSVCNKSVTFELEHQVDVSTYGEGSRVLSMLGSPRPPTVERKKPDGDAELDEKTL
Ga0210394_100000934F019865AGGGGGMAALWLVALLLGTGFAIATEPGAKWKILNVAIILGCMGLGLGLGYAIGLGSKNFGVVPNAAIPFSMMFGVLGAMVCVARNTWSAKS
Ga0210394_100000936F000552GAGGMRRKLEWVETKNFQGWVCTECAWAFNPSGPLVGQSIDEMKKRYEKQRDLEFTSHVCAEHPRTTKNPC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.