NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210394_10000320

Scaffold Ga0210394_10000320


Overview

Basic Information
Taxon OID3300021420 Open in IMG/M
Scaffold IDGa0210394_10000320 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)110561
Total Scaffold Genes85 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)63 (74.12%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000828Metagenome / Metatranscriptome872Y
F001932Metagenome / Metatranscriptome615Y
F002319Metagenome / Metatranscriptome571Y
F008095Metagenome / Metatranscriptome339Y

Sequences

Protein IDFamilyRBSSequence
Ga0210394_1000032013F002319GGAGMTSQVVNLQVTASIPIDCDFWSEDDGWKGLCKSPKVTVRGTSFEDAKKNMAAELQAHIERILCEHPKRSARRVA
Ga0210394_1000032018F001932GGAGGMRRKLVFWLVFLIAGFLIGFILQYSRLERIQQELSASTKQLGSCQSSQQLAQLRDTATMMYLEAVSKNYGKAGEYSRRVFDQAQQIAISTEDPALRTLLRDALATRDQITADLAKGDGAALSEIQPVLFKLEQTAKY
Ga0210394_1000032056F008095GGAGMDKSGDQDRRKGATEQDQQNQGGNTSMQGQLGHRDENAELKNADSDLSG
Ga0210394_1000032060F000828N/AMKKQSIFDQQYRVVAVQSDRLLIRGILSGEVLTIINPELEIPLTQEDYPPGKLIALTDPSGVHLN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.