NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210394_10000823

Scaffold Ga0210394_10000823


Overview

Basic Information
Taxon OID3300021420 Open in IMG/M
Scaffold IDGa0210394_10000823 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)56773
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)45 (78.95%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007603Metagenome / Metatranscriptome348Y
F016582Metagenome / Metatranscriptome246Y
F020987Metagenome / Metatranscriptome221Y
F061071Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0210394_1000082321F007603AGGAGMIGSTQKWWGVAALALLCIAPCAFASSNLTMTGAGNNVMDNVYVGPYYATVNGAVNTPVICDDFADETYIGSSWNYTPNTFSTLGSALWGNQTQNYEGAAWLTLQMLSLNSSPGNATQVGYLSYAIWSLFDSAALNGLNSTQLAGVESWLGMIPSNLTASQFSNFVILTPQGCTNGPGSCPGQEFMMLVPEGGSAAMYLLFTALSCFAAILFRRRGQAAAARSSIA
Ga0210394_1000082323F020987GGAMRNNSEHSFAIIRFNEKTYISGGVVAVVKGTESAQKTLNDYEWCQSQEDRSSGWRYFMEETDLQPGIDPSKATKLRQLRLDLQESQAAGF
Ga0210394_1000082336F061071AGTAGMNLEVFNRMTKETTRNSKIALNYDRVALDSVRRNRRGKHHDLIQGIFQDLETLPVGSAIKLPLSGVDGITLANLRSAVHRASVARSLKVETLSDEENFYIWKGERVDL
Ga0210394_1000082343F016582GAGMQCASIQTELFLTLAEHYEHNPQEFVTLPQQTVDSSTARVAVAELRNEGYVEEQVRGVVRLTLRGYNVFKSKPHPAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.