NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210384_10053164

Scaffold Ga0210384_10053164


Overview

Basic Information
Taxon OID3300021432 Open in IMG/M
Scaffold IDGa0210384_10053164 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3671
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018252Metagenome / Metatranscriptome236Y
F038874Metagenome / Metatranscriptome165Y
F094472Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0210384_100531642F038874GAGGMKCSIIFLALLASAAWADDPKQPRTLGNAAVMHLYYYAPKTLEVTYVDSFLFKDEAACKEAISKALQIATPYASEGDLVTASCVGMNPPAAISHPKAIVSNQATEL
Ga0210384_100531643F094472GGAMIPLIFVIFEDMDSAAIAALTAARDCPHQYECGGVIYEDSVHHYHVSAPLTSHKPFGLEILPYTEGRPDGWQIVADYHTHICSQHNRLFANFFSPADAIVNQTFHTVGYMLSLCDGNIRRYDPSQDDKDDEVVHFTSGREIYLTCGHISGWVEEL
Ga0210384_100531644F018252AGGMASLPSRYFVRLRPDLSPQVASEFRAFAKKPPSGKPPSDLRLILACARIDLSHSVFAKLTINLDDAAPAMDLWVPHEMILMIGDISEMGRAPVVFTPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.