Scaffold Ga0213920_1045845

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213920_1045845

Scaffold Ga0213920_1045845

Overview

Basic Information
Taxon OID	3300021438 Open in IMG/M
Scaffold ID	Ga0213920_1045845 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	925
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	33.9255	Long. (^o)	-83.5226	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000324	Metagenome / Metatranscriptome	1299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213920_10458452	F000324	AGGA	MTTISIAPKHSLTYDGATLNIFHVNKGEGLPRHQHLFAHATMCLHGSCALRKEGKEVVMTKDTIPFNLVANEWHEIEALEDGTVFANMFAEGKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.