NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213878_10035849

Scaffold Ga0213878_10035849


Overview

Basic Information
Taxon OID3300021444 Open in IMG/M
Scaffold IDGa0213878_10035849 Open in IMG/M
Source Dataset NameVellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1897
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.28Long. (o)-43.5919Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000037Metagenome / Metatranscriptome4230Y
F020661Metagenome / Metatranscriptome222Y
F096783Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0213878_100358491F020661N/ARERDARAAAAQRRLVASVDDLIQRCLKRQYEDALAVPLSPRLATLITQLETQEVSA
Ga0213878_100358492F000037GGCGGMAVVPIKERLILKLAATSRASGKWNDDYDVLAKGVVVGRLYKANKAPIGRPWLWVLAFEHYEDRKPTHGYEPTREAAMAAFAKSWRRE
Ga0213878_100358495F096783N/AFAWSNADGRLQFELQSAATAPKSAQRAAAPEEIERLRGVLDALKNDVKELTDTQHQAANTIAAMKAAEEDLRRHVPPPYWYSNPATLDLAIAKQPPPAGFAPPPRRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.